Aminomethyltransferase (AMT) antibody

Antigen: Aminomethyltransferase (AMT)

Synonyms: GCE, NKH, GCST, GCVT, EG434437, wu:fc31f04, wu:fd44b12, wu:fd54h12, zgc:103483, zgc:109741, MGC154901, F16J13.200, F16J13_200, T7P1.13, T7P1_13

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN406388

Additional Information

Alternative name: Aminomethyltransferase

Gene ID: AMT

UniProt: P48728

Immunogen: The immunogen for anti-AMT antibody: synthetic peptide directed towards the N terminal of human AMT

Sequence: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDF HLAHGGKMVA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-AMT antibody concentration is 1 mg/ml.

Description: The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase, MIM 238300), H protein (a lipoic acid-containing protein, MIM 238330), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase, MIM 238331). Glycine encephalopathy (GCE, MIM 605899) may be due to a defect in any one of these enzymes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2102 D13811.1 1-2102 2103-2117 BC044792.1 3271-3285

Characteristics: Antigen Size: 403 amino acids

Molecular Weight: 44kDa

Application Details

Application Notes: WB Suggested Anti-AMT Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, Organelles

Restrictions: For Research Use only

Images

WB Suggested Anti-AMT Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung

Publications

Product: Kure, Kato, Dinopoulos et al.: "Comprehensive mutation analysis of GLDC, AMT, and GCSH in nonketotic hyperglycinemia." in: Human mutation, Vol. 27, Issue 4, pp. 343-52, 2006 (PubMed).