Aminomethyltransferase antibody (N-Term)

Catalog No. ABIN631086

Product Details anti-Aminomethyltransferase Antibody

Target: Aminomethyltransferase (AMT)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Aminomethyltransferase antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AMT antibody was raised against the N terminal of AMT

Purification: Affinity purified

Immunogen: AMT antibody was raised using the N terminal of AMT corresponding to a region with amino acids QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AMT Blocking Peptide, catalog no. 33R-7703, is also available for use as a blocking control in assays to test for specificity of this AMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Aminomethyltransferase

Target: Aminomethyltransferase (AMT)

Alternative Name: AMT (AMT Products)

Synonyms: F16J13.200 antibody, F16J13_200 antibody, T7P1.13 antibody, T7P1_13 antibody, wu:fc31f04 antibody, wu:fd44b12 antibody, wu:fd54h12 antibody, zgc:103483 antibody, zgc:109741 antibody, GCE antibody, GCST antibody, GCVT antibody, NKH antibody, EG434437 antibody, aminomethyltransferase antibody, Glycine cleavage T-protein family antibody, Aminomethyltransferase antibody, aminomethyltransferase L homeolog antibody, AMT antibody, AT4G12130 antibody, AT1G60990 antibody, Tb11.01.1440 antibody, Palpr_0614 antibody, Ocepr_1643 antibody, Celal_2914 antibody, Deima_1002 antibody, Deipr_1956 antibody, Bacsa_3405 antibody, Celly_0288 antibody, Weevi_0527 antibody, Fluta_3952 antibody, Marky_0785 antibody, Spico_1217 antibody, Poras_1228 antibody, Halhy_3617 antibody, amt antibody, amt.L antibody, Amt antibody

Background: The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.

Molecular Weight: 44 kDa (MW of target protein)