Lymphocyte Cytosolic Protein 1 (LCP1) antibody

Antigen: Lymphocyte Cytosolic Protein 1 (LCP1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN406419

Additional Information

Alternative name: Plastin 2 / LCP1

Gene ID: LCP1

UniProt: P13796

Immunogen: The immunogen for anti-LCP1 antibody: synthetic peptide directed towards the C terminal of human LCP1

Sequence: ILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPK ISTSLPVLDL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-LCP1 antibody concentration is 1 mg/ml.

Description: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 627 amino acids

Molecular Weight: 70kDa

Application Details

Application Notes: WB Suggested Anti-LCP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-LCP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta

Publications

Product: Klemke, Rafael, Wabnitz et al.: "Phosphorylation of ectopically expressed L-plastin enhances invasiveness of human melanoma cells." in: International journal of cancer. Journal international du cancer, Vol. 120, Issue 12, pp. 2590-9, 2007 (PubMed).