Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Lymphocyte Cytosolic Protein 1 (LCP1) antibody

Antigen

Lymphocyte Cytosolic Protein 1 (LCP1)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Zebrafish

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN406419
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Plastin 2 / LCP1
Gene ID LCP1
UniProt P13796
Immunogen The immunogen for anti-LCP1 antibody: synthetic peptide directed towards the C terminal of human LCP1
Sequence ILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPK ISTSLPVLDL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-LCP1 antibody concentration is 1 mg/ml.
Description Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 627 amino acids
Molecular Weight 70kDa

Application Details

Application Notes WB Suggested Anti-LCP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Klemke, Rafael, Wabnitz et al.: "Phosphorylation of ectopically expressed L-plastin enhances invasiveness of human melanoma cells." in: International journal of cancer. Journal international du cancer, Vol. 120, Issue 12, pp. 2590-9, 2007 (PubMed).

Alternatives

Alternatives for antigen "Lymphocyte Cytosolic Protein 1 (LCP1)", type "Antibodies"
Hosts Rabbit (13), Mouse (7)
Reactivities Human (18), Mouse (Murine) (5), Rat (Rattus) (5), Chicken (2), Cow (Bovine) (2), Dog (Canine) (2), Cat (Feline) (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (19), Immunofluorescence (IF) (9), Immunoprecipitation (IP) (8), ELISA (7), Immunohistochemistry (IHC) (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunocytochemistry (ICC) (2)
Epitopes C-Term (1), Headpiece Region (1), N-Term (1)