Stratifin (SFN) antibody

Antigen: Stratifin (SFN)

Synonyms: YWHAS, Er, Mme1, Ywhas, LOC408037, LOC100220844

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Zebrafish, Dog (Canine)

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN406432

Additional Information

Alternative name: 14-3-3 protein sigma / SFN

Gene ID: SFN

UniProt: P31947

Immunogen: The immunogen for anti-SFN antibody: synthetic peptide directed towards the middle region of human SFN

Sequence: FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTL IMQLLRDNLT

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SFN antibody concentration is 1 mg/ml.

Description: SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.

Characteristics: Antigen Size: 248 amino acids

Molecular Weight: 28kDa

Application Details

Application Notes: WB Suggested Anti-SFN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SFN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T

anti-Stratifin (SFN) antibody (Image 2)

Publications

Product: Yang, Dicker, Chen et al.: "CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2." in: Cell cycle (Georgetown, Tex.), Vol. 7, Issue 5, pp. 670-82, 2008 (PubMed).

Lu, Zhu, Wen et al.: "Nicotinamide N-methyl transferase (NNMT) gene polymorphisms and risk for spina bifida." in: Birth defects research. Part A, Clinical and molecular teratology, Vol. 82, Issue 10, pp. 670-5, 2008 (PubMed).