KIAA0892 (KIAA0892) antibody

Antigen: KIAA0892 (KIAA0892)

Synonyms: MAU2L, mau-2, KIAA0892, MGC75361, Mau-2, C77863, C79014, Kiaa0892, MGC159271, mKIAA0892, A930019L04Rik, scc4, kiaa0892

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN406484

Additional Information

Alternative name: KIAA0892

Gene ID: KIAA0892

UniProt: Q9Y6X3

Immunogen: The immunogen for anti-KIAA0892 antibody: synthetic peptide directed towards the middle region of human KIAA0892

Sequence: MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQN GPNTSLASLL

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KIAA0892 antibody concentration is 1 mg/ml.

Description: KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

Characteristics: Antigen Size: 613 amino acids

Molecular Weight: 69kDa

Application Details

Application Notes: WB Suggested Anti-KIAA0892 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-KIAA0892 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Publications

Product: Seitan, Banks, Laval et al.: "Metazoan Scc4 homologs link sister chromatid cohesion to cell and axon migration guidance." in: PLoS biology, Vol. 4, Issue 8, pp. e242, 2006 (PubMed).