Ribose 5-Phosphate Isomerase A (RPIA) antibody

Antigen: Ribose 5-Phosphate Isomerase A (RPIA)

Synonyms: MGC83218, MGC127056, F10A8.17, F10A8_17, ribose-5-phosphate isomerase 2, RPI2, F7O18.28, F7O18_28, MFC16.20, MFC16_20, F23N20.9, F23N20_9, RADIAL SWELLING 10, RIBOSE 5-PHOSPHATE ISOMERASE, RPI, RSW10

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN406525

Additional Information

Alternative name: RPIA

Gene ID: RPIA

UniProt: P49247

Immunogen: The immunogen for anti-RPIA antibody: synthetic peptide directed towards the N terminal of human RPIA

Sequence: MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSH VRLPGRAQSG

Cross-Reactivity: Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RPIA antibody concentration is 1 mg/ml.

Description: Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.

Characteristics: Antigen Size: 311 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-RPIA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cancer, Metabolism

Restrictions: For Research Use only

Images

WB Suggested Anti-RPIA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

Publications

Product: Huck, Verhoeven, Struys et al.: "Ribose-5-phosphate isomerase deficiency: new inborn error in the pentose phosphate pathway associated with a slowly progressive leukoencephalopathy." in: American journal of human genetics, Vol. 74, Issue 4, pp. 745-51, 2004 (PubMed).