Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406547

Chromosome 9 Open Reading Frame 43 (C9orf43) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C9orf43
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406547
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C9orf43 antibody: synthetic peptide directed towards the middle region of human C9orf43
Sequence PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDE DEEDQSSGAE
Predicted Reactivity Dog : 91%
Characteristics This is a rabbit polyclonal antibody against C9orf43. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C9orf43
Background The function of the C9orf43 protein remains unknown.
Molecular Weight 52kDa
Gene ID 257169
NCBI Accession NP_689999, NM_152786
UniProt Q8TAL5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C9orf43 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives for antigen "Chromosome 9 Open Reading Frame 43 (C9orf43)", type "Antibodies"
Hosts (16), (1)
Reactivities (16)
Applications (10), (8), (5), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1), (1)
Beacon