Chromosome 9 Open Reading Frame 43 (C9orf43) (Middle Region) antibody

Details for Product No. ABIN406547
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C9orf43
Epitope
Middle Region
(1), (1), (1)
Reactivity
Dog (Canine), Human
(15)
Host
Rabbit
(15), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN406547
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C9orf43
Sequence PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDE DEEDQSSGAE
Predicted Reactivity Dog : 91 %
Characteristics This is a rabbit polyclonal antibody against C9orf43. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C9orf43
Background The function of the C9orf43 protein remains unknown.
Molecular Weight 52 kDa
Gene ID 257169
NCBI Accession NM_152786, NP_689999
UniProt Q8TAL5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 461 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 9 Open Reading Frame 43 (C9orf43) (Middle Region) antibody WB Suggested Anti-C9orf43 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9...." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Hosts (15), (1)
Reactivities (15)
Applications (10), (7), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
back to top