POC1 Centriolar Protein Homolog B (Chlamydomonas) (POC1B) antibody

Antigen: POC1 Centriolar Protein Homolog B (Chlamydomonas) (POC1B)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN406560

Additional Information

Alternative name: WDR51B

Gene ID: WDR51B

UniProt: Q8TC44

Immunogen: The immunogen for anti-WDR51B antibody: synthetic peptide directed towards the N terminal of human WDR51B

Sequence: GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFS ADGQFLATAS

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-WDR51B antibody concentration is 1 mg/ml.

Description: WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.

Characteristics: Antigen Size: 478 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-WDR51B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-WDR51B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung

Publications

Product: Higa, Wu, Ye et al.: "CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation." in: Nature cell biology, Vol. 8, Issue 11, pp. 1277-83, 2006 (PubMed).