Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 2 Open Reading Frame 53 (C2orf53) (Middle Region) antibody

Details for Product No. ABIN406582
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(1)
Reactivity
Human
(14)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (6), (3), (3), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406582
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C2orf53
Sequence PQGKATQACGHQLPASQPPAAQARADPVPGTPSQTRSFRS AGLQSPNSPR
Predicted Reactivity Human :100 %,   Crab-eating macaque :90 %,  
Characteristics This is a rabbit polyclonal antibody against C2orf53. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C2orf53
Background The exact functions of C2orf53 remain unknown.
Molecular Weight 45 kDa
Gene ID 339779
NCBI Accession NM_178553, NP_848648
UniProt Q53SZ7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 412 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 2 Open Reading Frame 53 (C2orf53) (Middle Region) antibody WB Suggested Anti-C2orf53 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406582
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top