Peptidase D (PEPD) antibody

Antigen: Peptidase D (PEPD)

Synonyms: MGC10905, PROLIDASE, Pep4, Pep-4, MGC95081, cb1000, fj78g11, wu:fj78g11, MGC89151, MGC115123

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN406596

Additional Information

Alternative name: Peptidase D / PEPD

Gene ID: PEPD

UniProt: P12955

Immunogen: The immunogen for anti-PEPD antibody: synthetic peptide directed towards the middle region of human PEPD

Sequence: LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLR TARHLQPGMV

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PEPD antibody concentration is 1 mg/ml.

Description: Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-74 DC395475.1 1-74 75-101 DC385464.1 1-27 102-2018 BC015027.1 1-1917

Characteristics: Antigen Size: 493 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-PEPD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PEPD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Publications

Product: Surazynski, Donald, Cooper et al.: "Extracellular matrix and HIF-1 signaling: the role of prolidase." in: International journal of cancer. Journal international du cancer, Vol. 122, Issue 6, pp. 1435-40, 2008 (PubMed).