Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406601

Chromosome 1 Open Reading Frame 103 (C1orf103) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C1orf103, RIF1, RP11-96K19.1, 2010012G17Rik, 4933421E11Rik, AI450568, Rif1, RGD1306520
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406601
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C1orf103 antibody: synthetic peptide directed towards the middle region of human C1orf103
Sequence SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNK NYTEDIFPVT
Predicted Reactivity Human :100%,   Rat :90%,   Mouse :90%,   Dog :78%,  
Characteristics This is a rabbit polyclonal antibody against C1orf103. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C1orf103
Background The specific function of this protein remains unknown.
Molecular Weight 85kDa
Gene ID 55791
NCBI Accession NP_060842, NM_018372
UniProt Q5T3J3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C1orf103 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "Chromosome 1 Open Reading Frame 103 (C1orf103)", type "Antibodies"
Hosts (19), (1)
Reactivities (18), (13), (13), (12), (12), (12), (1)
Applications (10), (10), (4), (3), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1), (1)
Beacon