Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 1 Open Reading Frame 103 (C1orf103) (Middle Region) antibody

Details for Product No. ABIN406601
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C1orf103, RIF1, RP11-96K19.1, 2010012G17Rik, 4933421E11Rik, AI450568, Rif1, RGD1306520
Epitope
Middle Region
(2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(18), (13), (13), (12), (12), (12), (1)
Host
Rabbit
(18), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (10), (3), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406601
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C1orf103
Sequence SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNK NYTEDIFPVT
Predicted Reactivity Human :100 %,   Rat :90 %,   Mouse :90 %,   Dog :70 %,  
Characteristics This is a rabbit polyclonal antibody against C1orf103. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C1orf103
Background The specific function of this protein remains unknown.
Molecular Weight 85 kDa
Gene ID 55791
NCBI Accession NM_018372, NP_060842
UniProt Q5T3J3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 769 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 1 Open Reading Frame 103 (C1orf103) (Middle Region) antibody WB Suggested Anti-C1orf103 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406601
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top