Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406602

ChaC, Cation Transport Regulator Homolog 2 (E. Coli) (CHAC2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2510006C20Rik, RGD1309120, chac, fj84c08, im:7150709, wu:fj84c08, zgc:110055
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406602
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHAC2 antibody: synthetic peptide directed towards the N terminal of human CHAC2
Sequence MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHR GVPGKPGRVV
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against CHAC2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CHAC2
Background The specific function of this protein remains unknown.
Molecular Weight 21kDa
Gene ID 494143
NCBI Accession NP_001008708, NM_001008708
UniProt Q8WUX2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHAC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "ChaC, Cation Transport Regulator Homolog 2 (E. Coli) (CHAC2)", type "Antibodies"
Hosts (7), (1)
Reactivities (7), (2), (2)
Applications (8), (2), (2), (1)
Epitopes (2), (1), (1), (1), (1), (1)
Beacon