ChaC, Cation Transport Regulator Homolog 2 (E. Coli) (CHAC2) (N-Term) antibody

Details for Product No. ABIN406602
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2510006C20Rik, RGD1309120, chac, fj84c08, im:7150709, wu:fj84c08, zgc:110055
Epitope
N-Term
(1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Human, Chicken
(7), (3), (3)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN406602
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CHAC2
Sequence MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHR GVPGKPGRVV
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against CHAC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CHAC2
Background The specific function of this protein remains unknown.
Molecular Weight 21 kDa
Gene ID 494143
NCBI Accession NM_001008708, NP_001008708
UniProt Q8WUX2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 184 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ChaC, Cation Transport Regulator Homolog 2 (E. Coli) (CHAC2) (N-Term) antibody WB Suggested Anti-CHAC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Placenta
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (7), (1)
Reactivities (7), (3), (3)
Applications (8), (3), (2), (1)
Epitopes (1), (1), (1), (1)
back to top