Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406627

Spermatogenesis Associated 7 (SPATA7) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI661438, B230306G18Rik, HSD3, RSD-3, Wmp1, HSD-3.1, LCA3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406627
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SPATA7 antibody: synthetic peptide directed towards the middle region of human SPATA7
Sequence FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAE TKNMTDSEMN
Predicted Reactivity Horse : 100%, Human : 100%, Pig : 100%, Bovine : 92%, Guinea pig : 92%, Mouse : 92%, Dog : 85%, Rat : 85%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against SPATA7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SPATA7
Background The function of the SPATA7 protein remains unknown.
Molecular Weight 68kDa
Gene ID 55812
NCBI Accession NP_060888, NM_018418
UniProt Q9P0W8
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SPATA7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Spermatogenesis Associated 7 (SPATA7)", type "Antibodies"
Hosts (7)
Reactivities (6), (2)
Applications (7), (4)
Epitopes (3), (2), (1), (1)
Beacon