Did you know that you can buy products from over 140 different suppliers from us?

Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP) (Middle Region) antibody

Details for Product No. ABIN406629
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PLPP, AB041662, 1600027H05Rik, Rbp1, CIN, PLP, dJ37E16.5
Epitope
Middle Region
(3), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(6), (2), (1), (1)
Host
Rabbit
(4), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406629
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PDXP
Sequence DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYM FECITENFSI
Predicted Reactivity Dog : 100 %, Horse : 100 %, Mouse : 100 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against PDXP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PDXP
Background Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]).
Molecular Weight 32 kDa
Gene ID 57026
NCBI Accession NM_020315, NP_064711
UniProt Q96GD0
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 296 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP) (Middle Region) antibody WB Suggested Anti-PDXP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Gohla, Birkenfeld, Bokoch: "Chronophin, a novel HAD-type serine protein phosphatase, regulates cofilin-dependent actin dynamics." in: Nature cell biology, Vol. 7, Issue 1, pp. 21-9, 2005 (PubMed).

Hosts (4), (3)
Reactivities (6), (2), (1), (1)
Applications (6), (3), (1), (1)
Epitopes (3), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406629
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top