Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406629

Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PLPP, AB041662, 1600027H05Rik, Rbp1, CIN, PLP, dJ37E16.5
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406629
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PDXP antibody: synthetic peptide directed towards the middle region of human PDXP
Sequence DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYM FECITENFSI
Predicted Reactivity Dog : 100%, Horse : 100%, Mouse : 100%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against PDXP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PDXP
Background Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]).
Molecular Weight 32kDa
Gene ID 57026
NCBI Accession NP_064711, NM_020315
UniProt Q96GD0
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PDXP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gohla, Birkenfeld, Bokoch: "Chronophin, a novel HAD-type serine protein phosphatase, regulates cofilin-dependent actin dynamics." in: Nature cell biology, Vol. 7, Issue 1, pp. 21-9, 2005 (PubMed).

Alternatives for antigen "Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP)", type "Antibodies"
Hosts (4), (3)
Reactivities (6), (2), (1), (1)
Applications (6), (4), (1)
Epitopes (3), (1), (1)
Beacon