Did you know that you can buy products from over 140 different suppliers from us?

Sterile alpha Motif Domain Containing 8 (SAMD8) (Middle Region) antibody

Details for Product No. ABIN406705
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110053F04Rik, 1700010P07Rik, SMSr, CG32380, CG8572, CG8576, Css3beta, Dmel\\CG32380, dSMSr, dmSMSr
Epitope
Middle Region
(9), (8), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Human
(12), (3), (2)
Host
Rabbit
(17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (9)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406705
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SAMD8
Sequence MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVL LLHKHRSILL
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against SAMD8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SAMD8
Background SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.
Molecular Weight 36 kDa
Gene ID 142891
NCBI Accession NM_144660, NP_653261
UniProt Q5JSC8
Research Area Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 326 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sterile alpha Motif Domain Containing 8 (SAMD8) (Middle Region) antibody WB Suggested Anti-SAMD8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406705
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top