Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406705

Sterile alpha Motif Domain Containing 8 (SAMD8) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110053F04Rik, 1700010P07Rik, SMSr, CG32380, CG8572, CG8576, Css3beta, Dmel\\CG32380, dSMSr, dmSMSr
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406705
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SAMD8 antibody: synthetic peptide directed towards the middle region of human SAMD8
Sequence MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVL LLHKHRSILL
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against SAMD8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SAMD8
Background SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.
Molecular Weight 36kDa
Gene ID 142891
NCBI Accession NP_653261, NM_144660
UniProt Q5JSC8
Research Area Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SAMD8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Alternatives for antigen "Sterile alpha Motif Domain Containing 8 (SAMD8)", type "Antibodies"
Hosts (11)
Reactivities (6), (4), (2)
Applications (11), (4)
Epitopes (4), (2), (2), (1)
Beacon