Sterile alpha Motif Domain Containing 8 (SAMD8) antibody

Antigen: Sterile alpha Motif Domain Containing 8 (SAMD8)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN406705

Additional Information

Alternative name: SAMD8 / SMSr

Gene ID: SAMD8

UniProt: Q5JSC8

Immunogen: The immunogen for anti-SAMD8 antibody: synthetic peptide directed towards the middle region of human SAMD8

Sequence: MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVL LLHKHRSILL

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SAMD8 antibody concentration is 1 mg/ml.

Description: SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.

Characteristics: Antigen Size: 326 amino acids

Molecular Weight: 36kDa

Application Details

Application Notes: WB Suggested Anti-SAMD8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SAMD8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Publications

Product: Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).