Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406780

Zinc Finger and BTB Domain Containing 6 (ZBTB6) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms A830092L04Rik, ZID, Zfp482, Znf482, ZNF482
Reactivity
»Alternatives Cow (Bovine), Human, Rat (Rattus)
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406780
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB6 antibody: synthetic peptide directed towards the middle region of human ZBTB6
Sequence ESNALQSTVESLTSERKEMKSPELSTVDIGFKDNEICILH VESISTAGVE
Cross-Reactivity Cow (Bovine), Human, Rat (Rattus)
Predicted Reactivity Horse : 100%, Human : 100%, Pig : 85%, Bovine : 78%, Rat : 78%
Characteristics Antigen Size: 424 amino acids
Purification Affinity Purified
Alternative Name ZBTB6
Background ZBTB6 Contains 1 BTB (POZ) domain and 4 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
Molecular Weight 48kDa
Gene ID ZBTB6
UniProt Q15916
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes WB Suggested Anti-ZBTB6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-ZBTB6 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 6 (ZBTB6)", type "Antibodies"
Hosts (32), (4)
Reactivities (35), (22), (14), (2), (1)
Applications (26), (16), (10), (5), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (3), (3), (2), (2), (1), (1), (1)
Beacon