Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Lipase, Endothelial (LIPG) antibody

Antigen

Lipase, Endothelial (LIPG)
Synonyms EL, EDL, PRO719, MGC55345, zgc:55345, MGC69106, LIPG, lipe
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rabbit, Dog (Canine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN486808
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Lipase, Endothelial (LIPG) antibody

anti-Lipase, Endothelial (LIPG) antibody (2)

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name LIPG
Gene ID LIPG
UniProt Q9Y5X9
Immunogen The immunogen for anti-LIPG antibody: synthetic peptide directed towards the middle region of human LIPG
Sequence VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMK NETSPTVELP
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-LIPG antibody concentration is 1 mg/ml.
Description LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 500 amino acids
Molecular Weight 55kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-LIPG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cardiovascular, Atherosclerosis, Metabolism, Enzymes
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Willer, Sanna, Jackson et al.: "Newly identified loci that influence lipid concentrations and risk of coronary artery disease." in: Nature genetics, Vol. 40, Issue 2, pp. 161-9, 2008 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Lipase, Endothelial (LIPG)", type "Antibodies"
Hosts Rabbit (53), Mouse (33), Goat (4)
Reactivities Human (81), Mouse (Murine) (41), Rat (Rattus) (40), Horse (Equine) (35), Pig (Porcine) (20), Chicken (18), Cow (Bovine) (18), Dog (Canine) (18), Sheep (Ovine) (2)
Applications Western Blotting (WB) (53), Immunofluorescence (IF) (50), Immunohistochemistry (IHC) (30), Flow Cytometry (FACS) (15), ELISA (14), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (5), Immunoelectron Microscopy (IEM) (2), Immunoprecipitation (IP) (2), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Conjugates Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Biotin (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2)
Epitopes AA 19-32 (2), Internal Region (2), C-Term (1), Center (1), N-Term (1)