Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486953

Zinc Finger and BTB Domain Containing 20 (ZBTB20) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1300017A20Rik, 7330412A13Rik, A930017C21Rik, D16Wsu73e, DPZF, HOF, ODA-8S, Oda8, Zfp288, RGD1560387, ZNF288
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN486953
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB20 antibody: synthetic peptide directed towards the middle region of human ZBTB20
Sequence QPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTY LPALFTTQPA
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against ZBTB20. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZBTB20
Background ZBTB20 may be a transcription factor that may be involved in hematopoiesis, oncogenesis, and immune responses.
Molecular Weight 73kDa
Gene ID 26137
NCBI Accession NP_056457, NM_015642
UniProt Q9HC78-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZBTB20 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 20 (ZBTB20)", type "Antibodies"
Hosts (18)
Reactivities (17), (13), (13), (13), (12)
Applications (10), (8), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
Beacon