Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger and BTB Domain Containing 20 (ZBTB20) (Middle Region) antibody

Details for Product No. ABIN486953
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DPZF, HOF, ODA-8S, ZNF288, 1300017A20Rik, 7330412A13Rik, A930017C21Rik, D16Wsu73e, Oda8, Zfp288, RGD1560387
Epitope
Middle Region
(2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(20), (13), (13), (13), (12)
Host
Rabbit
(18), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (10), (5), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN486953
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZBTB20
Sequence QPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTY LPALFTTQPA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against ZBTB20. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZBTB20
Background ZBTB20 may be a transcription factor that may be involved in hematopoiesis, oncogenesis, and immune responses.
Molecular Weight 73 kDa
Gene ID 26137
NCBI Accession NM_015642, NP_056457
UniProt Q9HC78-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 668 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Validation Images
back to top