Ladybird Homeobox 1 (LBX1) (Middle Region) antibody

Details for Product No. ABIN486985
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Lbx1h, RGD1564197, HPX-6, HPX6, LBX1H, homeobox
Epitope
Middle Region
(6), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Dog (Canine), Cow (Bovine), Pig (Porcine), Human, Chicken
(9), (2)
Host
Rabbit
(7), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (7)
Pubmed 1 reference available
Catalog no. ABIN486985
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LBX1
Sequence LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGR DGMTIFGQRQ
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against LBX1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LBX1
Background LBX1 is the transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles.
Molecular Weight 30 kDa
Gene ID 10660
NCBI Accession NM_006562, NP_006553
UniProt P52954
Research Area Stem Cells, Transcription Factors, Neurogenesis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 281 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10...." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Hosts (7), (3)
Reactivities (9), (2)
Applications (10), (7)
Epitopes (6), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top