Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ladybird Homeobox 1 (LBX1) antibody

Antigen

Ladybird Homeobox 1 (LBX1)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish, Xenopus laevis, Dog (Canine), Pig (Porcine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN486985
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name LBX1
Gene ID LBX1
UniProt P52954
Immunogen The immunogen for anti-LBX1 antibody: synthetic peptide directed towards the middle region of human LBX1
Sequence LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGR DGMTIFGQRQ
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-LBX1 antibody concentration is 1 mg/ml.
Description LBX1 is the transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles.
Characteristics Antigen Size: 281 amino acids
Molecular Weight 30kDa

Application Details

Application Notes WB Suggested Anti-LBX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Stem Cells, Transcription Factors, Neurogenesis
Restrictions For Research Use only

Publications

Product Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives

Alternatives for antigen "Ladybird Homeobox 1 (LBX1)", type "Antibodies"
Hosts Rabbit (24)
Reactivities Human (22), Mouse (Murine) (20), Chicken (18), Cow (Bovine) (18), Dog (Canine) (18), Horse (Equine) (18), Rat (Rattus) (18), Zebrafish (Danio rerio) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (9), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (2), Internal Region (1), Internal Region,AA 126-155 (1)