Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486993

Olfactory Receptor, Family 13, Subfamily C, Member 5 (OR13C5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OR9-11
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN486993
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the N terminal of human OR13C5
Sequence ICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTT ECVLLGVMAF
Predicted Reactivity Short-tailed gray opossum :100%,   Dog :100%,   Human :100%,   Rat :84%,  
Characteristics This is a rabbit polyclonal antibody against OR13C5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name OR13C5
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Molecular Weight 36kDa
Gene ID 138799
NCBI Accession NP_001004482, NM_001004482
UniProt Q8NGS8
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OR13C5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives for antigen "Olfactory Receptor, Family 13, Subfamily C, Member 5 (OR13C5)", type "Antibodies"
Hosts (7)
Reactivities (7), (2), (2), (1)
Applications (7), (1)
Epitopes (2), (1), (1)
Beacon