Olfactory Receptor, Family 13, Subfamily C, Member 5 (OR13C5) antibody

Antigen: Olfactory Receptor, Family 13, Subfamily C, Member 5 (OR13C5)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN486993

Additional Information

Alternative name: Olfactory receptor 13C5

Gene ID: OR13C5

UniProt: Q8NGS8

Immunogen: The immunogen for anti-OR13C5 antibody: synthetic peptide directed towards the N terminal of human OR13C5

Sequence: ICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTT ECVLLGVMAF

Cross-Reactivity: Dog (Canine), Human, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-OR13C5 antibody concentration is 1 mg/ml.

Description: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Characteristics: Antigen Size: 318 amino acids

Molecular Weight: 36kDa

Application Details

Application Notes: WB Suggested Anti-OR13C5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-OR13C5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Publications

Product: Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).