POU Class 3 Homeobox 3 (POU3F3) antibody

Antigen: POU Class 3 Homeobox 3 (POU3F3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN487007

Additional Information

Alternative name: POU3F3

Gene ID: POU3F3

UniProt: P20264

Immunogen: The immunogen for anti-POU3F3 antibody: synthetic peptide directed towards the N terminal of human POU3F3

Sequence: GGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQ SDFMQGAMAA

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-POU3F3 antibody concentration is 1 mg/ml.

Description: POU3F3 is the transcription factor that acts synergistically with SOX11 and SOX4. POU3F3 plays a role in neuronal development. POU3F3 is implicated in an enhancer activity at the embryonic met-mesencephalic junction, the enhancer element contains the octamer motif (5'-ATTTGCAT-3').POU3F3 is a member of the class III POU family of transcription factors (see POU3F1, MIM 602479) that are expressed in the central nervous system. The POU domain in these proteins is required for high affinity binding to octamer DNA sequences Sumiyama et al. (1996) [PubMed 8703082].[supplied by OMIM].

Characteristics: Antigen Size: 500 amino acids

Molecular Weight: 50kDa

Application Details

Application Notes: WB Suggested Anti-POU3F3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-POU3F3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate

Publications

Product: Wissmüller, Kosian, Wolf et al.: "The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors." in: Nucleic acids research, Vol. 34, Issue 6, pp. 1735-44, 2006 (PubMed).