Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487014

Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KHS, GCKR, KHS1, MAPKKKK5, fl74c10, wu:fl74c10, zgc:55719, zgc:55985, RGD1562028
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487014
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAP4K5 antibody: synthetic peptide directed towards the middle region of human MAP4K5
Sequence QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENP TAHSNLYILA
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 85%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against MAP4K5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MAP4K5
Background MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.This gene encodes a member of the serine/threonine protein kinase family, that is highly similar to yeast SPS1/STE20 kinase. Yeast SPS1/STE20 functions near the beginning of the MAP kinase signal cascades that is essential for yeast pheromone response. This kinase was shown to activate Jun kinase in mammalian cells, which suggested a role in stress response. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.
Molecular Weight 95kDa
Gene ID 11183
NCBI Accession NP_006566, NM_006575
UniProt Q9Y4K4
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAP4K5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wissing, Jänsch, Nimtz et al.: "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 3, pp. 537-47, 2007 (PubMed).

Alternatives for antigen "Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5)", type "Antibodies"
Hosts (24), (3)
Reactivities (26), (15), (14), (1), (1), (1), (1), (1)
Applications (15), (10), (9), (6), (4), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1), (1)
Beacon