Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5) antibody

Antigen: Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5)

Synonyms: KHS, GCKR, KHS1, MAPKKKK5, fl74c10, MGC55719, zgc:55719, zgc:55985, wu:fl74c10, 4432415E19Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN487014

Additional Information

Alternative name: MAP4K5

Gene ID: MAP4K5

UniProt: Q9Y4K4

Immunogen: The immunogen for anti-MAP4K5 antibody: synthetic peptide directed towards the middle region of human MAP4K5

Sequence: QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENP TAHSNLYILA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MAP4K5 antibody concentration is 1 mg/ml.

Description: MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.This gene encodes a member of the serine/threonine protein kinase family, that is highly similar to yeast SPS1/STE20 kinase. Yeast SPS1/STE20 functions near the beginning of the MAP kinase signal cascades that is essential for yeast pheromone response. This kinase was shown to activate Jun kinase in mammalian cells, which suggested a role in stress response. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Characteristics: Antigen Size: 846 amino acids

Molecular Weight: 95kDa

Application Details

Application Notes: WB Suggested Anti-MAP4K5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-MAP4K5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate

Publications

Product: Wissing, Jänsch, Nimtz et al.: "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 3, pp. 537-47, 2007 (PubMed).