Zinc Finger Protein 64 (Isoform 1,Isoform 2) antibody

Antigen: Zinc Finger Protein 64

Synonyms: znf64, znf338

Binding Site: Isoform 1,Isoform 2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN487024

Additional Information

Alternative name: ZFP64

Gene ID: ZFP64

UniProt: Q9NPA5

Immunogen: The immunogen for anti-ZFP64 antibody: synthetic peptide directed towards the middle region of human ZFP64

Sequence: AKKSFHCDICDASFMREDSLRSHKRQHSEYSESKNSDVTV LQFQIDPSKQ

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZFP64 antibody concentration is 1 mg/ml.

Description: ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. ZFP64 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 681 amino acids

Molecular Weight: 75kDa

Application Details

Application Notes: WB Suggested Anti-ZFP64 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZFP64 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Publications

Product: Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).