Zinc Finger and BTB Domain Containing 4 (ZBTB4) antibody

Antigen: Zinc Finger and BTB Domain Containing 4 (ZBTB4)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN487027

Additional Information

Alternative name: ZBTB4

Gene ID: ZBTB4

UniProt: Q9P1Z0

Immunogen: The immunogen for anti-ZBTB4 antibody: synthetic peptide directed towards the middle region of human ZBTB4

Sequence: RPGGTPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGE AGGGSTAAEE

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZBTB4 antibody concentration is 1 mg/ml.

Description: ZBTB4 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 1013 amino acids

Molecular Weight: 105kDa

Application Details

Application Notes: WB Suggested Anti-ZBTB4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Spleen.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZBTB4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Spleen

Publications

Product: Weber, Marquardt, Elzi et al.: "Zbtb4 represses transcription of P21CIP1 and controls the cellular response to p53 activation." in: The EMBO journal, Vol. 27, Issue 11, pp. 1563-74, 2008 (PubMed).