Toll-Like Receptor 9 (TLR9) antibody

Antigen: Toll-Like Receptor 9 (TLR9)

Synonyms: CD289

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN487042

Additional Information

Alternative name: CD289 / TLR9

Gene ID: TLR9

UniProt: Q9NR96

Immunogen: The immunogen for anti-TLR9 antibody: synthetic peptide directed towards the N terminal of human TLR9

Sequence: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLV LKDSSLSWLN

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TLR9 antibody concentration is 1 mg/ml.

Description: TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 1032 amino acids

Molecular Weight: 113kDa

Application Details

Application Notes: WB Suggested Anti-TLR9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Immunology, Inflammation

Restrictions: For Research Use only

Images

WB Suggested Anti-TLR9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate

Publications

Product: Ramirez-Ortiz, Specht, Wang et al.: "Toll-like receptor 9-dependent immune activation by unmethylated CpG motifs in Aspergillus fumigatus DNA." in: Infection and immunity, Vol. 76, Issue 5, pp. 2123-9, 2008 (PubMed).