Short Stature Homeobox 2 (SHOX2) antibody

Antigen: Short Stature Homeobox 2 (SHOX2)

Synonyms: OG12, SHOT, OG12X, Prx3, Og12x, 6330543G17Rik, MGC65884, zgc:65884, zgc:77344, SHOX2, og12, shot, og12x, ogi2x

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN487044

Additional Information

Alternative name: SHOX2 / SHOT

Gene ID: SHOX2

UniProt: O60902

Immunogen: The immunogen for anti-SHOX2 antibody: synthetic peptide directed towards the N terminal of human SHOX2

Sequence: EELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPT GCTEAGRDDR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SHOX2 antibody concentration is 1 mg/ml.

Description: SHOX2 is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.

Characteristics: Antigen Size: 331 amino acids

Molecular Weight: 35kDa

Application Details

Application Notes: WB Suggested Anti-SHOX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SHOX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Publications

Product: Hillman, Green, Brenner: "An unappreciated role for RNA surveillance." in: Genome biology, Vol. 5, Issue 2, pp. R8, 2004 (PubMed).