Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72) antibody

Antigen

Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72)

Synonyms Tcfl1, vps72, MGC82727, si:dkeyp-24a7.1, Vps72, YL-1, ACYPI009531, YL1, CFL1, Swc2, TCFL1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN487057
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name VPS72
Gene ID VPS72
UniProt Q15906
Immunogen The immunogen for anti-VPS72 antibody: synthetic peptide directed towards the N terminal of human VPS72
Sequence GGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGE AEEPRRKRRV
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-VPS72 antibody concentration is 1 mg/ml.
Description VPS72 could be a DNA-binding transcriptional regulator. VPS72 may be involved in chromatin modification and remodeling.
Characteristics Antigen Size: 364 amino acids
Molecular Weight 40kDa

Application Details

Application Notes WB Suggested Anti-VPS72 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: ACHN cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).

Alternatives

Alternatives for antigen "Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72)", type "Antibodies"
Hosts Rabbit (14), Mouse (1)
Reactivities Human (14), Mouse (Murine) (10), Rat (Rattus) (6), Cow (Bovine) (3), Dog (Canine) (3), Rabbit (2), Xenopus laevis (2), Zebrafish (2), Cat (Feline) (1), Chicken (1)
Applications Western Blotting (WB) (15), ELISA (9), Immunohistochemistry (IHC) (3), Immunofluorescence (IF) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1), Immunoprecipitation (IP) (1)
Epitopes N-Term (3), Internal Region (1)