Zinc Finger Protein 711 (N-Term) antibody

Details for Product No. ABIN487086
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2810409C01Rik, A230078I01Rik, Znf711, RGD1562768, si:dkey-152p16.4, zvep, ZNF6, CMPX1, MRX97, ZNF4, ZNF5, Zfp711, dJ75N13.1
Epitope
N-Term
(1)
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(1)
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Catalog no. ABIN487086
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF711
Sequence LEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAE DDVEIGGTEI
Predicted Reactivity Human : 100 %, Bovine : 90 %, Chicken : 90 %, Guinea pig : 90 %, Horse : 90 %, Pig : 90 %, Rabbit : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against ZNF711. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF711
Background ZNF711 may be involved in transcriptional regulation.This gene encodes a zinc finger protein of unknown function. It bears similarity to a zinc finger protein which acts as a transcriptional activator. This gene lies in a region of the X chromosome which has been associated with mental retardation.
Molecular Weight 86 kDa
Gene ID 7552
NCBI Accession NM_021998, NP_068838
UniProt Q9Y462
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 761 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 711 (N-Term) antibody WB Suggested Anti-ZNF711 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (1)
Reactivities (1)
Applications (1)
Epitopes (1)
back to top