Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487086

Zinc Finger Protein 711 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2810409C01Rik, A230078I01Rik, Znf711, RGD1562768, si:dkey-152p16.4, zvep, ZNF6, CMPX1, MRX97, ZNF4, ZNF5, Zfp711, dJ75N13.1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487086
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF711 antibody: synthetic peptide directed towards the N terminal of human ZNF711
Sequence LEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAE DDVEIGGTEI
Predicted Reactivity Human : 100%, Bovine : 92%, Chicken : 92%, Guinea pig : 92%, Horse : 92%, Pig : 92%, Rabbit : 92%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against ZNF711. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF711
Background ZNF711 may be involved in transcriptional regulation.This gene encodes a zinc finger protein of unknown function. It bears similarity to a zinc finger protein which acts as a transcriptional activator. This gene lies in a region of the X chromosome which has been associated with mental retardation.
Molecular Weight 86kDa
Gene ID 7552
NCBI Accession NP_068838, NM_021998
UniProt Q9Y462
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF711 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 711", type "Antibodies"
Hosts (1)
Reactivities (1)
Applications (1)
Epitopes (1)
Beacon