Claudin 7 (CLDN7) antibody

Antigen: Claudin 7 (CLDN7)

Synonyms: CEPTRL2, CPETRL2, Hs.84359, claudin-1, cb388, claudin7, wu:fd19f08, MGC124679, MGC53400, MGC75689, CLDN7, MGC128273

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN487100

Additional Information

Alternative name: Claudin-7 / CLDN7

Gene ID: CLDN7

UniProt: O95471

Immunogen: The immunogen for anti-CLDN7 antibody: synthetic peptide directed towards the middle region of human CLDN7

Sequence: GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSY PKSNSSKEYV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CLDN7 antibody concentration is 1 mg/ml.

Description: Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 211 amino acids

Molecular Weight: 22kDa

Application Details

Application Notes: WB Suggested Anti-CLDN7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CLDN7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung

Publications

Product: Kleinberg, Holth, Trope et al.: "Claudin upregulation in ovarian carcinoma effusions is associated with poor survival." in: Human pathology, Vol. 39, Issue 5, pp. 747-57, 2008 (PubMed).