Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487108

TSC22 Domain Family, Member 2 (TSC22D2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TILZ4a, TILZ4b, TILZ4c, 1810043J12Rik, 5530402M19Rik, cb869, id:ibd5097, kiaa0669, wu:fa55e04, zgc:92475, TSC22D2, tsc22d2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487108
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TSC22D2 antibody: synthetic peptide directed towards the C terminal of human TSC22D2
Sequence PVVKPPVADSLANPLQLTPMNSLATSVFSIAIPVDGDEDR NPSTAFYQAF
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against TSC22D2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TSC22D2
Background TSC22D2 belongs to the TSC-22/Dip/Bun family and the function remains unknown.
Molecular Weight 79kDa
Gene ID 9819
NCBI Accession NP_055594, NM_014779
UniProt O75157
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TSC22D2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gevaert, Goethals, Martens et al.: "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." in: Nature biotechnology, Vol. 21, Issue 5, pp. 566-9, 2003 (PubMed).

Alternatives for antigen "TSC22 Domain Family, Member 2 (TSC22D2)", type "Antibodies"
Hosts (13), (3)
Reactivities (15), (5), (3), (3), (3), (1), (1)
Applications (16), (4), (3)
Epitopes (7), (6), (2), (2), (2)
Beacon