TSC22 Domain Family, Member 2 (TSC22D2) (C-Term) antibody

Details for Product No. ABIN487108
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TILZ4a, TILZ4b, TILZ4c, 1810043J12Rik, 5530402M19Rik, cb869, id:ibd5097, kiaa0669, wu:fa55e04, zgc:92475, TSC22D2, tsc22d2
Epitope
C-Term
(7), (5), (2), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
(15), (5), (3), (3), (3), (1), (1)
Host
Rabbit
(13), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(16), (3), (3)
Pubmed 1 reference available
Catalog no. ABIN487108
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TSC22D2
Sequence PVVKPPVADSLANPLQLTPMNSLATSVFSIAIPVDGDEDR NPSTAFYQAF
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against TSC22D2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TSC22D2
Background TSC22D2 belongs to the TSC-22/Dip/Bun family and the function remains unknown.
Molecular Weight 79 kDa
Gene ID 9819
NCBI Accession NM_014779, NP_055594
UniProt O75157
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 780 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Gevaert, Goethals, Martens et al.: "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." in: Nature biotechnology, Vol. 21, Issue 5, pp. 566-9, 2003 (PubMed).

Hosts (13), (3)
Reactivities (15), (5), (3), (3), (3), (1), (1)
Applications (16), (3), (3)
Epitopes (7), (5), (2), (2), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top