TSC22 Domain Family, Member 2 (TSC22D2) antibody

Antigen: TSC22 Domain Family, Member 2 (TSC22D2)

Synonyms: TILZ4a, TILZ4b, TILZ4c, KIAA0669, 1810043J12Rik, 5530402M19Rik, tsc22d2, TSC22D2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN487108

Additional Information

Alternative name: TSC22D2

Gene ID: TSC22D2

UniProt: O75157

Immunogen: The immunogen for anti-TSC22D2 antibody: synthetic peptide directed towards the C terminal of human TSC22D2

Sequence: PVVKPPVADSLANPLQLTPMNSLATSVFSIAIPVDGDEDR NPSTAFYQAF

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TSC22D2 antibody concentration is 1 mg/ml.

Description: TSC22D2 belongs to the TSC-22/Dip/Bun family and the function remains unknown.

Characteristics: Antigen Size: 780 amino acids

Molecular Weight: 79kDa

Application Details

Application Notes: WB Suggested Anti-TSC22D2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-TSC22D2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Product: Gevaert, Goethals, Martens et al.: "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." in: Nature biotechnology, Vol. 21, Issue 5, pp. 566-9, 2003 (PubMed).