Zinc Finger Protein 646 (ZNF646) (N-Term) antibody

Details for Product No. ABIN487110
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
(2)
Reactivity
Mouse (Murine), Dog (Canine), Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Catalog no. ABIN487110
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF646
Sequence VVNFTGGQEPTQSPPAEEERRYKCSQCGKTYKHAGSLTNH RQSHTLGIYP
Predicted Reactivity Horse : 100 %, Human : 100 %, Dog : 90 %
Characteristics This is a rabbit polyclonal antibody against ZNF646. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF646
Background ZNF646 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 201 kDa
Gene ID 9726
NCBI Accession NM_014699, NP_055514
UniProt Q8IVD8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1832 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Hosts (2)
Reactivities (1)
Applications (1)
Epitopes (2)
back to top