Zinc Finger Protein 646 (ZNF646) antibody

Antigen: Zinc Finger Protein 646 (ZNF646)

Synonyms: KIAA0296

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN487110

Additional Information

Alternative name: ZNF646

Gene ID: ZNF646

UniProt: Q8IVD8

Immunogen: The immunogen for anti-ZNF646 antibody: synthetic peptide directed towards the N terminal of human ZNF646

Sequence: VVNFTGGQEPTQSPPAEEERRYKCSQCGKTYKHAGSLTNH RQSHTLGIYP

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF646 antibody concentration is 1 mg/ml.

Description: ZNF646 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Characteristics: Antigen Size: 1832 amino acids

Molecular Weight: 201kDa

Application Details

Application Notes: WB Suggested Anti-ZNF646 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF646 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver

Publications

Product: Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).