Mediator Complex Subunit 27 (MED27) antibody

Antigen: Mediator Complex Subunit 27 (MED27)

Synonyms: CRSP34, Med27, Trap37, dCRSP34, dTRAP37, DmelCG1245, CG1245, MGC66302, zgc:66302, MED27, CRSP8, crsp8, med27, MGC134262, CRAP34, TRAP37, MGC11274, Crsp8, AA682045, D2Ertd434e, 1500015J03Rik, 2310042P07Rik, RGD1564993, DKFZp459I1912

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Xenopus laevis, Chicken, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN487113

Additional Information

Alternative name: MED27

Gene ID: MED27

UniProt: Q6P2C8

Immunogen: The immunogen for anti-MED27 antibody: synthetic peptide directed towards the middle region of human MED27

Sequence: LSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNE NVYTEDGKLD

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MED27 antibody concentration is 1 mg/ml.

Description: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. MED27 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Characteristics: Antigen Size: 311 amino acids

Molecular Weight: 35kDa

Synonyms: CRSP34, Med27, Trap37, dCRSP34, dTRAP37, DmelCG1245, CG1245, MGC66302, zgc:66302, MED27, CRSP8, crsp8, med27, MGC134262, CRAP34, TRAP37, MGC11274, Crsp8, AA682045, D2Ertd434e, 1500015J03Rik, 2310042P07Rik, RGD1564993, DKFZp459I1912

Application Details

Application Notes: WB Suggested Anti-MED27 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MED27 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Publications

Product: Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).