Zinc Finger Protein 83 (ZNF83) antibody

Antigen: Zinc Finger Protein 83 (ZNF83)

Synonyms: HPF1, ZNF816B, FLJ11015, FLJ14876, FLJ30097, FLJ90585, MGC33853

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN487140

Additional Information

Alternative name: ZNF83

Gene ID: ZNF83

UniProt: Q6PI08

Immunogen: The immunogen for anti-ZNF83 antibody: synthetic peptide directed towards the N terminal of human ZNF83

Sequence: HGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYD HMEKSVNSSS

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF83 antibody concentration is 1 mg/ml.

Description: ZNF83 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 15 C2H2-type zinc fingers. ZNF83 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 516 amino acids

Molecular Weight: 60kDa

Application Details

Application Notes: WB Suggested Anti-ZNF83 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF83 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Product: Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).