Zinc Finger Protein 485 (ZNF485) antibody

Antigen: Zinc Finger Protein 485 (ZNF485)

Synonyms: ZNF485

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN487145

Additional Information

Alternative name: ZNF485

Gene ID: ZNF485

Immunogen: The immunogen for anti-ZNF485 antibody: synthetic peptide directed towards the C terminal of human ZNF485

Sequence: SSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHN KERAMKCS

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF485 antibody concentration is 1 mg/ml.

Description: ZNF485 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers and 1 KRAB domain. ZNF485 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 402 amino acids

Molecular Weight: 46kDa

Application Details

Application Notes: WB Suggested Anti-ZNF485 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF485 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Product: Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).