Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487192

ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
RLI, Oabp, RNS41, C79080, Rnaseli, Rns4i, wu:fb34c09, wu:fe47b01, wu:fi09g07, zgc:111906, zgc:56045, OABP, ABC38, RNS4I, RNASEL1, RNASELI, ABCE1, DDBDRAFT_0188931, DDBDRAFT_0191227, DDB_0188931, DDB_0 ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487192
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ABCE1 antibody: synthetic peptide directed towards the C terminal of human ABCE1
Sequence LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKS GNYFFLDD
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%, African clawed frog : 92%
Characteristics This is a rabbit polyclonal antibody against ABCE1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ABCE1
Background ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene.
Molecular Weight 67kDa
Gene ID 6059
NCBI Accession NP_001035809, NM_001040876
UniProt P61221
Research Area Immunology, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ABCE1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Shea, Ishwad, Bunker et al.: "RNASEL and RNASEL-inhibitor variation and prostate cancer risk in Afro-Caribbeans." in: The Prostate, Vol. 68, Issue 4, pp. 354-9, 2008 (PubMed).

Alternatives for antigen "ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1)", type "Antibodies"
Hosts (37), (10)
Reactivities (40), (16), (16), (15), (12), (3)
Applications (35), (19), (10), (4), (3), (3), (3), (2), (1)
Conjugates (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (7), (2), (1), (1)
Beacon