Did you know that you can buy products from over 140 different suppliers from us?

ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1) (C-Term) antibody

Details for Product No. ABIN487192
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
ABCE1, DDBDRAFT_0188931, DDBDRAFT_0191227, DDB_0188931, DDB_0191227, abce1, MGC69546, DKFZp469K1416, ABC38, OABP, RLI, RNASEL1, RNASELI, RNS4I, C79080, Oabp, RNS41, Rnaseli, wu:fb34c09, wu:fe47b01, wu ... show more
ABCE1, DDBDRAFT_0188931, DDBDRAFT_0191227, DDB_0188931, DDB_0191227, abce1, MGC69546, DKFZp469K1416, ABC38, OABP, RLI, RNASEL1, RNASELI, RNS4I, C79080, Oabp, RNS41, Rnaseli, wu:fb34c09, wu:fe47b01, wu:fi09g07, zgc:111906, zgc:56045, Rns4i show less
Epitope
C-Term
(10), (8), (4), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Dog (Canine), Xenopus laevis, Human, Chicken
(43), (17), (16), (14), (12), (3)
Host
Rabbit
(39), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(36), (19), (10), (9), (4), (3), (3), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487192
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ABCE1
Sequence LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKS GNYFFLDD
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against ABCE1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ABCE1
Background ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene.
Molecular Weight 67 kDa
Gene ID 6059
NCBI Accession NM_001040876, NP_001035809
UniProt P61221
Research Area Immunology, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 599 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1) (C-Term) antibody WB Suggested Anti-ABCE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
Background publications Shea, Ishwad, Bunker et al.: "RNASEL and RNASEL-inhibitor variation and prostate cancer risk in Afro-Caribbeans." in: The Prostate, Vol. 68, Issue 4, pp. 354-9, 2008 (PubMed).

Validation Images
back to top