ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1) antibody

Antigen: ATP-Binding Cassette, Sub-Family E (OABP), Member 1 (ABCE1)

Synonyms: ABCE1, RLI, Oabp, RNS41, C79080, Rnaseli, Rns4i, abce1, MGC53437, MGC56045, zgc:56045, wu:fb34c09, wu:fe47b01, wu:fi09g07, zgc:111906, MGC69546, MGC139587, DKFZp469K1416, OABP, ABC38, RNS4I, RNASEL1, RNASELI

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Chicken, Dog (Canine), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN487192

Additional Information

Alternative name: ABCE1

Gene ID: ABCE1

UniProt: P61221

Immunogen: The immunogen for anti-ABCE1 antibody: synthetic peptide directed towards the C terminal of human ABCE1

Sequence: LAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKS GNYFFLDD

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ABCE1 antibody concentration is 1 mg/ml.

Description: ABCE1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action.The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene.

Characteristics: Antigen Size: 599 amino acids

Molecular Weight: 67kDa

Synonyms: ABCE1, RLI, Oabp, RNS41, C79080, Rnaseli, Rns4i, abce1, MGC53437, MGC56045, zgc:56045, wu:fb34c09, wu:fe47b01, wu:fi09g07, zgc:111906, MGC69546, MGC139587, DKFZp469K1416, OABP, ABC38, RNS4I, RNASEL1, RNASELI

Application Details

Application Notes: WB Suggested Anti-ABCE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Immunology, Metabolism

Restrictions: For Research Use only

Images

WB Suggested Anti-ABCE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate

Publications

Product: Shea, Ishwad, Bunker et al.: "RNASEL and RNASEL-inhibitor variation and prostate cancer risk in Afro-Caribbeans." in: The Prostate, Vol. 68, Issue 4, pp. 354-9, 2008 (PubMed).