Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 45, Member 3 (SLC45A3) (Middle Region) antibody

Details for Product No. ABIN487197
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1309764, PRST, IPCA6, IPCA-2, IPCA-6, IPCA-8, PCANAP2, PCANAP6, PCANAP8, 2210413P12Rik, AU023994, AU043764, Pcanap6, MGC68967, zgc:162897
Epitope
Middle Region
(8), (7), (5), (3), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(29), (21), (12), (12), (12), (12)
Host
Rabbit
(38), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(30), (21), (11), (10), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487197
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SLC45A3
Sequence LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLF LQCAISLVFS
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against SLC45A3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLC45A3
Background SLC45A3 is a multi-pass membrane protein. It belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family. It is a marker for prostate cells. It may be used, in case of prostate cancers, as a target antigen for protate carcinomas-directed cytotoxic T-cell lymphocytes.
Molecular Weight 59 kDa
Gene ID 85414
NCBI Accession NM_033102, NP_149093
UniProt Q96JT2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 553 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Solute Carrier Family 45, Member 3 (SLC45A3) (Middle Region) antibody WB Suggested Anti-SLC45A3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Helgeson, Tomlins, Shah et al.: "Characterization of TMPRSS2:ETV5 and SLC45A3:ETV5 gene fusions in prostate cancer." in: Cancer research, Vol. 68, Issue 1, pp. 73-80, 2008 (PubMed).

Hosts (38), (1)
Reactivities (29), (21), (12), (12), (12), (12)
Applications (30), (21), (11), (10), (2), (1), (1), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (5), (3), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487197
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top