Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487197

Solute Carrier Family 45, Member 3 (SLC45A3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1309764, PRST, IPCA6, IPCA-2, IPCA-6, IPCA-8, PCANAP2, PCANAP6, PCANAP8, 2210413P12Rik, AU023994, AU043764, Pcanap6, MGC68967, zgc:162897
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487197
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC45A3 antibody: synthetic peptide directed towards the middle region of human SLC45A3
Sequence LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLF LQCAISLVFS
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against SLC45A3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC45A3
Background SLC45A3 is a multi-pass membrane protein. It belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family. It is a marker for prostate cells. It may be used, in case of prostate cancers, as a target antigen for protate carcinomas-directed cytotoxic T-cell lymphocytes.
Molecular Weight 59kDa
Gene ID 85414
NCBI Accession NP_149093, NM_033102
UniProt Q96JT2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC45A3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Helgeson, Tomlins, Shah et al.: "Characterization of TMPRSS2:ETV5 and SLC45A3:ETV5 gene fusions in prostate cancer." in: Cancer research, Vol. 68, Issue 1, pp. 73-80, 2008 (PubMed).

Alternatives for antigen "Solute Carrier Family 45, Member 3 (SLC45A3)", type "Antibodies"
Hosts (34), (1)
Reactivities (31), (16), (12), (12), (12), (12)
Applications (26), (17), (12), (10), (2), (2), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (4), (3), (2), (1), (1)
Beacon