Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5) (N-Term) antibody

Details for Product No. ABIN487228
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CAT2, ECAC1, OTRPC3, CaT2, Ecac1, D630033B11, ECAC, TRPV5
Epitope
N-Term
(4), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(30), (22), (19), (13), (13), (13), (1), (1)
Host
Rabbit
(27), (7), (6), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(32), (14), (12), (10), (3), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN487228
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TRPV5
Sequence MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGA LGETALHIAA
Predicted Reactivity Human : 100 %, Pig : 90 %, Bovine : 80 %, Dog : 80 %, Guinea pig : 80 %, Mouse : 80 %, Rat : 80 %, Horse : 70 %, Rabbit : 70 %
Characteristics This is a rabbit polyclonal antibody against TRPV5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRPV5
Background TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level.
Molecular Weight 82 kDa
Gene ID 56302
NCBI Accession NM_019841, NP_062815
UniProt Q9NQA5
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 729 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5) (N-Term) antibody WB Suggested Anti-TRPV5 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
anti-Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5) (N-Term) antibody (2) Sample Type: 1-4. hRetinal pigment epithelial cells, 4 individual donors (20ug)
Primary Dilution: 1:1000
Secondary Antibody: goat anti-rabbit-AP
Secondary Dilution: 1:2000
Image Submitted by: Brian Kennedy
Indiana University Northwest .

anti-Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5) (N-Term) antibody (3) Sample Type: hRetinal pigment epithelial cells
Green: primary
Red: nuclear
Primary Dilution: 1:200
Secondary Antibody: goat anti-rabbit-Alexa 488
Secondary Dilution: 1:500
Image Submitted by: Brian Kennedy
Indiana University Northwest .

Product cited in: Cha, Wu, Huang: "Protein kinase C inhibits caveolae-mediated endocytosis of TRPV5." in: American journal of physiology. Renal physiology, Vol. 294, Issue 5, pp. F1212-21, 2008 (PubMed).

Hosts (27), (7), (6), (2)
Reactivities (30), (22), (19), (13), (13), (13), (1), (1)
Applications (32), (14), (12), (10), (3), (1), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (3), (2), (2), (1), (1), (1), (1), (1)
back to top