Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487228

Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CAT2, ECAC1, OTRPC3, CaT2, Ecac1, D630033B11, ECAC, TRPV5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN487228
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5
Sequence MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGA LGETALHIAA
Predicted Reactivity Human : 100%, Pig : 92%, Bovine : 84%, Dog : 84%, Guinea pig : 84%, Mouse : 84%, Rat : 84%, Horse : 76%, Rabbit : 76%
Characteristics This is a rabbit polyclonal antibody against TRPV5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRPV5
Background TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level.
Molecular Weight 82kDa
Gene ID 56302
NCBI Accession NP_062815, NM_019841
UniProt Q9NQA5
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRPV5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Cha, Wu, Huang: "Protein kinase C inhibits caveolae-mediated endocytosis of TRPV5." in: American journal of physiology. Renal physiology, Vol. 294, Issue 5, pp. F1212-21, 2008 (PubMed).

Alternatives for antigen "Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5)", type "Antibodies"
Hosts (30), (7), (6), (3)
Reactivities (32), (21), (19), (13), (13), (13), (2), (1)
Applications (36), (17), (11), (10), (7), (3), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (6), (4), (4), (3), (3), (2), (2), (2), (1)
Beacon