UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6) antibody

Antigen: UDP-Gal:betaGal beta 1,3-Galactosyltransferase Polypeptide 6 (B3GALT6)

Synonyms: beta3GalT6, B3GALT6, MGC69183, dyak_GLEANR_663, DyakGE22868, GE22868, beta3galt6, dere_GLEANR_10535, DereGG10628, GG10628, dper_GLEANR_3106, DperGL21178, GL21178, dsec_GLEANR_3487, DsecGM20673, GM20673, dpse_GLEANR_8882, DpseGA28758, GA28758

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN487236

Additional Information

Alternative name: B3GALT6

Gene ID: B3GALT6

UniProt: Q96L58

Immunogen: The immunogen for anti-B3GALT6 antibody: synthetic peptide directed towards the C terminal of human B3GALT6

Sequence: VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATL AREGRLCKRE

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-B3GALT6 antibody concentration is 1 mg/ml.

Description: B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.

Characteristics: Antigen Size: 329 amino acids

Molecular Weight: 37kDa

Synonyms: beta3GalT6, B3GALT6, MGC69183, dyak_GLEANR_663, DyakGE22868, GE22868, beta3galt6, dere_GLEANR_10535, DereGG10628, GG10628, dper_GLEANR_3106, DperGL21178, GL21178, dsec_GLEANR_3487, DsecGM20673, GM20673, dpse_GLEANR_8882, DpseGA28758, GA28758

Application Details

Application Notes: WB Suggested Anti-B3GALT6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-B3GALT6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Publications

Product: Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).