Did you know that you can buy products from over 140 different suppliers from us?

PARK2 Co-Regulated-Like (PACRGL) (Middle Region) antibody

Details for Product No. ABIN487246
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933428G09Rik, C4orf28, RGD1311045
Epitope
Middle Region
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(2)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487246
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C4orf28
Sequence PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVK GAPEKAIPLL
Predicted Reactivity Human, Rat (Rattus), Cow (Bovine), Dog (Canine), Pig (Porcine), Horse (Equine), Guinea Pig, Mouse (Murine), Rabbit
Characteristics This is a rabbit polyclonal antibody against C4orf28. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C4orf28
Background The function of this protein remains unknown.
Molecular Weight 24 kDa
Gene ID 133015
NCBI Accession NM_145048, NP_659485
UniProt Q8N7B6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 221 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PARK2 Co-Regulated-Like (PACRGL) (Middle Region) antibody WB Suggested Anti-C4orf28 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Small Intestine
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487246
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top