Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487246

PARK2 Co-Regulated-Like (PACRGL) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933428G09Rik, C4orf28, RGD1311045
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487246
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C4orf28 antibody: synthetic peptide directed towards the middle region of human C4orf28
Sequence PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVK GAPEKAIPLL
Characteristics This is a rabbit polyclonal antibody against C4orf28. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C4orf28
Background The function of this protein remains unknown.
Molecular Weight 24kDa
Gene ID 133015
NCBI Accession NP_659485, NM_145048
UniProt Q8N7B6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C4orf28 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "PARK2 Co-Regulated-Like (PACRGL)", type "Antibodies"
Hosts (3)
Reactivities (2)
Applications (3), (1)
Epitopes (1), (1)
Beacon