Did you know that you can buy products from over 140 different suppliers from us?

Ankyrin Repeat Domain 7 (ANKRD7) (Middle Region) antibody

Details for Product No. ABIN487256
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TSA806, AV278427, 4930532L20Rik, RGD1564660, ANKRD7
Epitope
Middle Region
(2), (2), (2)
Reactivity
Rat (Rattus), Mouse (Murine), Human
(7)
Host
Rabbit
(7), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487256
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ANKRD7
Sequence EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVN ASDNYQRTAL
Predicted Reactivity Human : 100 %, Rabbit : 90 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against ANKRD7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ANKRD7
Background ANKRD7 contains 5 ANK repeats. The exact function of ANKRD7 remains unknown.
Molecular Weight 17 kDa
Gene ID 56311
NCBI Accession NM_019644, NP_062618
UniProt Q92527
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 151 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ankyrin Repeat Domain 7 (ANKRD7) (Middle Region) antibody WB Suggested Anti-ANKRD7 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Background publications Ozaki, Kuroki, Hayashi et al.: "Isolation of three testis-specific genes (TSA303, TSA806, TSA903) by a differential mRNA display method." in: Genomics, Vol. 36, Issue 2, pp. 316-9, 1997 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487256
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top