Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Kelch-Like 3 (Drosophila) (KLHL3) antibody

Antigen

Kelch-Like 3 (Drosophila) (KLHL3)

Synonyms FLJ40871, KIAA1129, MGC44594, RGD1565218, KLHL3, DKFZp469O0524
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501301
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name KLHL3
Gene ID KLHL3
UniProt Q9UH77
Immunogen The immunogen for anti-KLHL3 antibody: synthetic peptide directed towards the N terminal of human KLHL3
Sequence CSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYT AEIEVTEENV
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-KLHL3 antibody concentration is 1 mg/ml.
Description KLHL3 protein contains a poxvirus and zinc finger domain at the N-terminus and six tandem repeats (kelch repeats) at the C-terminus. At the amino acid level, KLHL3 shares 77% similarity with Drosophila kelch and 89% similarity with Mayven (KLHL2), another human kelch homolog. At least three isoforms are produced and may be the result of alternative promoter usage. The KLHL3 maps within the smallest commonly deleted segment in myeloid leukemias characterized by a deletion of 5q, however, no inactivating mutations of KLHL3 could be detected in malignant myeloid disorders with loss of 5q.
Characteristics Antigen Size: 587 amino acids
Molecular Weight 65kDa

Application Details

Application Notes WB Suggested Anti-KLHL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: THP-1 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Schmutz, Martin, Terry et al.: "The DNA sequence and comparative analysis of human chromosome 5." in: Nature, Vol. 431, Issue 7006, pp. 268-74, 2004 (PubMed).

Alternatives

Alternatives for antigen "Kelch-Like 3 (Drosophila) (KLHL3)", type "Antibodies"
Hosts Rabbit (28)
Reactivities Human (28), Mouse (Murine) (22), Rat (Rattus) (22), Cow (Bovine) (19), Cat (Feline) (1), Chicken (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (12), ELISA (9), Immunohistochemistry (IHC) (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (2), Internal Region (1)