Kv Channel Interacting Protein 4 (KCNIP4) antibody

Antigen: Kv Channel Interacting Protein 4 (KCNIP4)

Synonyms: CALP, KCHIP4, MGC44947, Calp, KChIP4, Calp250, KChIP4a, AV032399, Kchip4, KCHIP4.2, KCNIP4, MGC115522, DKFZp459M1362

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN501313

Additional Information

Alternative name: KCNIP4

Gene ID: KCNIP4

UniProt: Q6PIL6

Immunogen: The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4

Sequence: NVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLL PCSAAKTSSP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KCNIP4 antibody concentration is 1 mg/ml.

Description: KCNIP4 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Characteristics: Antigen Size: 250 amino acids

Molecular Weight: 29kDa

Application Details

Application Notes: WB Suggested Anti-KCNIP4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Neurology

Restrictions: For Research Use only

Images

WB Suggested Anti-KCNIP4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle

Publications

Product: Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).