ADP-Dependent Glucokinase (ADPGK) (N-Term) antibody

Details for Product No. ABIN501314
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610017G09Rik, ADP-GK, Adp-gk, C77577, RGD1306103, ADPGK
Epitope
N-Term
(4), (3), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(28), (18), (17), (3), (2)
Host
Rabbit
(24), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(28), (13), (5), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN501314
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ADPGK
Sequence WRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHS RNDLEEAFIH
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Mouse : 80 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against ADPGK. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ADPGK
Background ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions.ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).
Molecular Weight 54 kDa
Gene ID 83440
NCBI Accession NM_031284, NP_112574
UniProt Q9BRR6
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 496 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Hosts (24), (4)
Reactivities (28), (18), (17), (3), (2)
Applications (28), (13), (5), (2), (1)
Epitopes (4), (3), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top