Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501314

ADP-Dependent Glucokinase (ADPGK) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610017G09Rik, ADP-GK, Adp-gk, C77577, RGD1306103, ADPGK
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501314
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ADPGK antibody: synthetic peptide directed towards the N terminal of human ADPGK
Sequence WRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHS RNDLEEAFIH
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Mouse : 85%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against ADPGK. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ADPGK
Background ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions.ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).
Molecular Weight 54kDa
Gene ID 83440
NCBI Accession NP_112574, NM_031284
UniProt Q9BRR6
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ADPGK antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "ADP-Dependent Glucokinase (ADPGK)", type "Antibodies"
Hosts (19), (4)
Reactivities (23), (13), (12), (3), (2)
Applications (23), (11), (3), (2), (1)
Epitopes (4), (2), (2), (2), (1)
Beacon